Protein Info for IAI47_14975 in Pantoea sp. MT58

Annotation: multidrug efflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 369 to 387 (19 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 257 (247 residues), 113.3 bits, see alignment E=2.4e-36 amino acids 217 to 411 (195 residues), 98.2 bits, see alignment E=9.8e-32 PF12832: MFS_1_like" amino acids 16 to 373 (358 residues), 47.7 bits, see alignment E=2.4e-16 PF00083: Sugar_tr" amino acids 42 to 122 (81 residues), 29.6 bits, see alignment E=6.8e-11 amino acids 251 to 387 (137 residues), 23.5 bits, see alignment E=5e-09

Best Hits

Swiss-Prot: 60% identical to MDTG_KLEP3: Multidrug resistance protein MdtG (mdtG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K08161, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 96% identity to pva:Pvag_0309)

MetaCyc: 60% identical to efflux pump MdtG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-342; TRANS-RXN0-589

Predicted SEED Role

"Multidrug-efflux transporter, major facilitator superfamily (MFS) (TC 2.A.1)" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>IAI47_14975 multidrug efflux MFS transporter (Pantoea sp. MT58)
MEPWKINLISVWFGCFFTGLAISQIIPFLPLYLEQLGVTGGESLSLWSGLTFSITFVVSA
AVAPLWGSLADRKGRKLMLLRAAFGMGVVILLQAFVTEAWQLLLLRALMGLTSGYIPNAM
ALVAAQVPRERSGWALSCVSTGQIGGVILGPMLGGLLADWVGLRTVFIVTAVLLMVSFLV
TLFLIKETGYIPVSKKDKLSGREVFRSLDNPKLMLCLFFTTMVIQMCNGSVNPILTLFVR
ELAPTAENIAFLSGVIAALPGVSALLAAPRLGRLGDRIGTQRILLATMVISLLLFVAMSF
VTSTTQLGILRFLLGFADGAMMPAVQTLLVCHSRDNITGRIFGYNQSFMYLGNVAGPLLG
AAVSAVAGFRWVFFATAVVVLINVLFLKRFYRRPKTELPLAEKSSAQPASAAESVKTQD