Protein Info for IAI47_14955 in Pantoea sp. MT58

Annotation: phosphate starvation-inducible protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07769: PsiF_repeat" amino acids 24 to 57 (34 residues), 61.7 bits, see alignment E=2.3e-21 amino acids 67 to 98 (32 residues), 55.3 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 50% identical to PSIF_ECOL6: Phosphate starvation-inducible protein PsiF (psiF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_0314)

Predicted SEED Role

"Phosphate starvation-inducible protein PsiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>IAI47_14955 phosphate starvation-inducible protein (Pantoea sp. MT58)
MKVGLMAMMMAGLLVSGLAGAAEKTPQQEKMTMCNQHAKSQDLKGDARKTFMSECLKKDS
KMSQMSPQQMKMKSCNGEAGDKKLAGDARKTFMSQCLKKS