Protein Info for IAI47_14930 in Pantoea sp. MT58

Annotation: shikimate kinase AroL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 5 to 119 (115 residues), 38.4 bits, E=1.8e-13
• PF01202: SKI
  • amino acids 11 to 167 (157 residues), 154.6 bits, E=2.4e-49

Best Hits

Swiss-Prot: 68% identical to AROL_ERWT9: Shikimate kinase 2 (aroL) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 95% identity to pva:Pvag_0319)

MetaCyc: 54% identical to shikimate kinase 2 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase III (EC 2.7.1.71)" in subsystem CBSS-562.2.peg.5158 SK3 including or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.71

Protein Sequence (174 amino acids)

>IAI47_14930 shikimate kinase AroL (Pantoea sp. MT58)
MSLPIFLIGARGCGKTTVGEALSQALGYAFTDTDHHLQLSTQRSVTEIVEAEGWEGFRAR
ETESLKAVTAPRTVIATGGGMILAEENCRFMQEHGQVIWLSASPEVLAERLESEPEAAQR
PTLTGRPIADEMSDVLRERAHLYQAAAHHQVNAMQAPECVVEEILLSLSLARAS