Protein Info for IAI47_14860 in Pantoea sp. MT58

Annotation: exonuclease subunit SbcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 1 to 225 (225 residues), 57.6 bits, E=2.4e-19
• TIGR00619: exonuclease SbcCD, D subunit
  • amino acids 1 to 253 (253 residues), 247.3 bits, E=1e-77
• PF12320: SbcD_C
  • amino acids 277 to 372 (96 residues), 63 bits, E=3e-21

Best Hits

Swiss-Prot: 63% identical to SBCD_ECOLI: Nuclease SbcCD subunit D (sbcD) from Escherichia coli (strain K12)

KEGG orthology group: K03547, exonuclease SbcD (inferred from 97% identity to pva:Pvag_0335)

MetaCyc: 63% identical to ATP-dependent structure-specific DNA nuclease - SbcD subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Exonuclease SbcD" in subsystem DNA repair, bacterial

Protein Sequence (399 amino acids)

>IAI47_14860 exonuclease subunit SbcD (Pantoea sp. MT58)
MRIIHTADWHLGQFFYNKSRAAEHQAFLDWLLIQIEQHQVDALIIAGDLFDTGTPPSYAR
EMFNRFVVALQPTGCQLIVLAGNHDSVATLNESRELLACLNTRVIATPQEQDDVLLLNTR
QGEPGTLLCAIPYLRPRDILRSRAGQSGRDKQTSLLEAIAHHYQQRFAAAQALGHALPII
ATGHLTTVGVSQSDSVRDIYIGTLDAFPASAFPAADYIALGHIHRAQRVAGSEHIRYSGS
PIPLSFDELGSEKSVFLLELAASGLQSVTPLVVPQAQPMQVLKGSLAQIAEQLHAFSTAE
QEKPTWLDIEVTTQEYLSDLQHQVETLTATLPVEVLLLRRSREQRQQSLARLDNETLSEL
KVEEVFARRLALDEKLQPAQIDEMTTLFRQTLAAMEETQ