Protein Info for IAI47_14845 in Pantoea sp. MT58

Annotation: PstS family phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF12849: PBP_like_2" amino acids 18 to 279 (262 residues), 117.3 bits, see alignment E=1.7e-37 TIGR02136: phosphate binding protein" amino acids 23 to 293 (271 residues), 215.5 bits, see alignment E=4.6e-68 PF12727: PBP_like" amino acids 44 to 213 (170 residues), 27.9 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 56% identical to PSTS_PSEAB: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 96% identity to pva:Pvag_0338)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>IAI47_14845 PstS family phosphate ABC transporter substrate-binding protein (Pantoea sp. MT58)
MRILLVLIVTLLPGLALAQHGTLSGNLSSVGSDTLGYLMTLWGEDFSRQAPGVNVQVQAS
GSSTAPTALAAGAAQLGPMSRPMQADERQAFEARYGYPPLAVPVAMDALVVVVNQRNPLQ
QIEPRQLDAIFSVTRLCGAHSVPLRWGDLGLTGAQWNKRPIQRYGRNSASGTWGFFKQQV
LCKGDFRSDVAEFPGSAAVVQAVAGNSRSIGYASFGFHLSGVKMLAVTNDQGQAIAPDAD
AIRSGRYPWARPLYLYVNKAPGKPLPPLVAAFLQQVLSPQGQRRVSEAGYLPLSDSQMAE
ARAALR