Protein Info for IAI47_14840 in Pantoea sp. MT58

Annotation: cobalamin-independent methionine synthase II family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01717: Meth_synt_2
  • amino acids 11 to 345 (335 residues), 47.3 bits, E=9e-17

Best Hits

Swiss-Prot: 56% identical to YXJH_BACSU: Uncharacterized protein YxjH (yxjH) from Bacillus subtilis (strain 168)

KEGG orthology group: K00549, 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC: 2.1.1.14] (inferred from 95% identity to pva:Pvag_0339)

Predicted SEED Role

"Methionine synthase II (cobalamin-independent)"

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-methionine biosynthesis I (5/5 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• S-adenosyl-L-methionine salvage I (4/4 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• S-adenosyl-L-methionine salvage II (2/3 steps found)
• seleno-amino acid biosynthesis (plants) (3/5 steps found)
• L-methionine biosynthesis III (2/4 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.14

Use Curated BLAST to search for 2.1.1.14

Protein Sequence (368 amino acids)

>IAI47_14840 cobalamin-independent methionine synthase II family protein (Pantoea sp. MT58)
MQRETAPFRADTVGSFLRPAAIKQAREAFAAGEIDAAALQQVEDEAIRDVVAKQRENGLK
VVTDGEFRRGWWHFDFFYGLNGVERYEAEQGIQFNGVQTKAHGVKVVSKLGFPADHPMLA
HFRFLQSIAGDAVSKMTIPSPSVLHFRGGRKVIDAEVYPDLADYFEDLAQTYKAAIQAFY
DAGCRYLQLDDTVWAYLCSEDQKRDIRERGDDPDQLAQIYAQVLNKALEDKPADLTVGLH
VCRGNFRSTWISEGGYGPVAEILFGSVNVDAFFLEYDNARSGGFEPLRYIKPGHQQVVLG
LITTKVGELEDPAQVKIRLEEAAQYVSLDQICLSPQCGFASTEEGNSLSEAQQWQKIRLV
VDIANQVW