Protein Info for IAI47_14835 in Pantoea sp. MT58

Annotation: branched-chain amino acid transporter carrier protein BrnQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 281 to 306 (26 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 339 to 341 (3 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 7 to 429 (423 residues), 522.8 bits, see alignment E=3.8e-161 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 14 to 415 (402 residues), 515.9 bits, see alignment E=4e-159

Best Hits

Swiss-Prot: 80% identical to BRNQ_SALTY: Branched-chain amino acid transport system 2 carrier protein (brnQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 99% identity to pva:Pvag_0340)

MetaCyc: 79% identical to branched chain amino acid transporter BrnQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-126; TRANS-RXN-126A; TRANS-RXN-126B

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>IAI47_14835 branched-chain amino acid transporter carrier protein BrnQ (Pantoea sp. MT58)
MTHRLTSKDILALGFMTFALFVGAGNIIFPPMVGIQSGEHVWTAAIGFLITAVGLPVMTV
IALARVGGGVDALSTPIGKVAGIVLATVCYLAVGPLFATPRTATVSFEMGIAPLTGDGAL
PLFIYSLIYFALVIGVSLYPGKLLDTVGHFLAPLKIIALTVLGVAALVWPAGGTIPATVD
YQHAAFSSGFVNGYLTMDTLGALVFGIVIVNAARSRGVDNAALLTRYTVLAGLIAGLGLT
LVYLCLFKLGAGSGALVDQNANGAAILHAYVQHTFGNMGSLFLAALIFVACMVTAVGLTC
ACAEFFAQYLPLSYKTLVFILGLFSMVVSNLGLSHLIQISIPVLTAIYPPCIVLVVLSFT
LNWWNKSSRIIAPAMLVSLLFGIVDAIKTTGFKDLLPAFSQHLPLADQGLAWLPPSLVML
LIAAVVDRVKGPEQVAVHS