Protein Info for IAI47_14755 in Pantoea sp. MT58

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 4 to 322 (319 residues), 395.7 bits, E=6.4e-123
• PF00586: AIRS
  • amino acids 28 to 136 (109 residues), 101.7 bits, E=3.4e-33
• PF02769: AIRS_C
  • amino acids 150 to 299 (150 residues), 42.4 bits, E=8.6e-15

Best Hits

Swiss-Prot: 76% identical to THIL_ECOL6: Thiamine-monophosphate kinase (thiL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 97% identity to pva:Pvag_0356)

MetaCyc: 76% identical to thiamine monophosphate kinase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate kinase. [EC: 2.7.4.16]

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• thiamine diphosphate salvage II (5/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage I (2/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (325 amino acids)

>IAI47_14755 thiamine-phosphate kinase (Pantoea sp. MT58)
MSCGEFELIARYFNRRTRSRRDVELGIGDDCALLSVPEKQTLAISTDTLVAGVHFLRDIH
PADLGYKALAVNLSDLAAMGADPAWLTLALTLPQVDESWLSAFSESLFELLEYYDMQLVG
GDTTRGPLSLTLAIHGLLPQGRALKRSGAKPGDWIFVTGTLGDSAAGLALLQHHCRINDP
AVHEALIKRHLRPMPRILQGQALRSLASSAVDISDGLISDLGHVLKASGCGARLNLDALP
LSAALRDHFEPEQVLRWALSGGEDYELCFTVPEVNRGALDVALGHLGVPYTCIGQIAPES
EGLTLLDNGKPATFRHKGFDHFDAK