Protein Info for IAI47_14730 in Pantoea sp. MT58

Annotation: exodeoxyribonuclease VII small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01280: exodeoxyribonuclease VII, small subunit
  • amino acids 10 to 65 (56 residues), 81.1 bits, E=2.4e-27
• PF02609: Exonuc_VII_S
  • amino acids 11 to 61 (51 residues), 73.6 bits, E=5.3e-25

Best Hits

Swiss-Prot: 79% identical to EX7S_SODGM: Exodeoxyribonuclease 7 small subunit (xseB) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 99% identity to pva:Pvag_0361)

MetaCyc: 75% identical to exodeoxyribonuclease VII subunit XseB (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Protein Sequence (80 amino acids)

>IAI47_14730 exodeoxyribonuclease VII small subunit (Pantoea sp. MT58)
MPKKAEQPASFETSLQQLEQIVSRLESGELPLEEALNEFERGVQLARNGQQTLQQAEQRV
RILLNDDKEADLTAFTPEND