Protein Info for IAI47_14720 in Pantoea sp. MT58

Annotation: protein deglycase YajL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 6 to 172 (167 residues), 160.1 bits, E=2.2e-51
• TIGR01383: DJ-1 family protein
  • amino acids 7 to 185 (179 residues), 196.6 bits, E=1.5e-62

Best Hits

Swiss-Prot: 74% identical to YAJL_SALTY: Protein/nucleic acid deglycase YajL (yajL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03152, 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis (inferred from 98% identity to pva:Pvag_0363)

MetaCyc: 72% identical to protein/nucleic acid deglycase 3 (Escherichia coli K-12 substr. MG1655)
4.2.1.-; RXN-17632 [EC: 3.5.1.124]

Predicted SEED Role

"DJ-1/YajL/PfpI superfamily, includes chaperone protein YajL (former ThiJ), parkinsonism-associated protein DJ-1, peptidases PfpI, Hsp31"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.124

Protein Sequence (198 amino acids)

>IAI47_14720 protein deglycase YajL (Pantoea sp. MT58)
MTANASVLVCLAHGSEETEAVTTIDLLVRAGLNVVTASVESDGSREIVCSRGVRLLADVT
LVEVADNDFAAIVLPGGLKGAETFRDSPLLVETVRQFHLNEKIVAAICAAAGTVLIPHDL
FPVGNMTGFPGLKETIPADKWMERRVVWDPRVNLLTSQGPGTAMDFALKLIDLLVGKEMA
REVAAQLVLAPGIYDYQA