Protein Info for IAI47_14720 in Pantoea sp. MT58
Annotation: protein deglycase YajL
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to YAJL_SALTY: Protein/nucleic acid deglycase YajL (yajL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K03152, 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis (inferred from 98% identity to pva:Pvag_0363)MetaCyc: 72% identical to protein/nucleic acid deglycase 3 (Escherichia coli K-12 substr. MG1655)
4.2.1.-; RXN-17632 [EC: 3.5.1.124]
Predicted SEED Role
"DJ-1/YajL/PfpI superfamily, includes chaperone protein YajL (former ThiJ), parkinsonism-associated protein DJ-1, peptidases PfpI, Hsp31"
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.1.124
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (198 amino acids)
>IAI47_14720 protein deglycase YajL (Pantoea sp. MT58) MTANASVLVCLAHGSEETEAVTTIDLLVRAGLNVVTASVESDGSREIVCSRGVRLLADVT LVEVADNDFAAIVLPGGLKGAETFRDSPLLVETVRQFHLNEKIVAAICAAAGTVLIPHDL FPVGNMTGFPGLKETIPADKWMERRVVWDPRVNLLTSQGPGTAMDFALKLIDLLVGKEMA REVAAQLVLAPGIYDYQA