Protein Info for IAI47_14705 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 354 (335 residues), 154.2 bits, see alignment E=6.8e-49 amino acids 278 to 392 (115 residues), 34.8 bits, see alignment E=1.4e-12 PF12832: MFS_1_like" amino acids 32 to 373 (342 residues), 31.9 bits, see alignment E=1.2e-11 PF00083: Sugar_tr" amino acids 46 to 188 (143 residues), 40.1 bits, see alignment E=3.4e-14

Best Hits

Swiss-Prot: 79% identical to YAJR_ECOLI: Inner membrane transport protein YajR (yajR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_0366)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>IAI47_14705 MFS transporter (Pantoea sp. MT58)
MNDNKMTPVELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGASETLIGLAIGIYGLA
QAIFQIPFGLLSDRIGRKPLIVGGLLLFVLGSVIAACTDSIWGIILGRALQGSGAIAAAV
MALLSDLTREQNRTKAMAFIGISFGVTFAIAMVVGPIVTHALGLHALFWMIAILASLGIV
ITLLVVPSASHHVLNRESGMVKGSFRKVLANPRLVKLNIGIFCLHVLLMSSFVALPGQFE
QAGFPAPEHWKVYLSTMLIAFAGVVPFIIYAEVKRRMKRVFVGCVGMIVIAEIVLWGAEG
HFWTLVVGVQLFFFAFNLMEAILPSLISKESPAGYKGTAMGIYSTSQFLGVAVGGSMGGW
VFGHFDAQTVFLVGAMVAAAWLFVSMTMQEPPYVSSLRIVLSDAALAVPNLEQRLKAQPG
VNSVFIVPEEKSAYIKIDSKVTSRPELEALLGSC