Protein Info for IAI47_14690 in Pantoea sp. MT58

Annotation: cytochrome o ubiquinol oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 16 to 202 (187 residues), 57.2 bits, E=1.3e-19
• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 25 to 204 (180 residues), 296.7 bits, E=4.1e-93

Best Hits

Swiss-Prot: 80% identical to CYOC_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 99% identity to pva:Pvag_0369)

MetaCyc: 80% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (204 amino acids)

>IAI47_14690 cytochrome o ubiquinol oxidase subunit III (Pantoea sp. MT58)
MSTETLKHHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAG
KDIFELPFVLVETALLLLSSITYGMAVISMNKEQKGAVIGWLALTFLFGLGFIGMEIYEF
HHLIAEGFGPDRSGFLSGFFTLVGTHGLHVTSGLIWMLVLMFQVSKRGLNATNRTRIMCL
SLFWHFLDVVWICVFTVVYLMGAM