Protein Info for IAI47_14675 in Pantoea sp. MT58

Annotation: muropeptide MFS transporter AmpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 223 to 249 (27 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 430 to 453 (24 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details PF13000: Acatn" amino acids 15 to 89 (75 residues), 36.6 bits, see alignment E=2.2e-13 PF07690: MFS_1" amino acids 16 to 365 (350 residues), 109.1 bits, see alignment E=2.4e-35 TIGR00901: AmpG-like permease" amino acids 24 to 362 (339 residues), 406.6 bits, see alignment E=5.3e-126

Best Hits

Swiss-Prot: 71% identical to AMPG_ECO57: Anhydromuropeptide permease (ampG) from Escherichia coli O157:H7

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 97% identity to pva:Pvag_0372)

MetaCyc: 71% identical to muropeptide:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-226; TRANS-RXN0-258

Predicted SEED Role

"AmpG permease"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>IAI47_14675 muropeptide MFS transporter AmpG (Pantoea sp. MT58)
MNHYLRLFSQKNAAVLLLLGFASGLPLALTSGTLQAWMTVENVDLKTIGFFSLVGQAYVF
KFLWSPMMDRYTPPFLGRRRGWLLLSQLALVGGIFAMGFLQPGRDLTLMAALAVLIAFCS
ASQDIVFDAWKTDILPPEERGSGAAITVLGYRLAMLISGGLALWLADRYLGWQATYWLMA
LMMVPGIIATLAASEPDTRISTPHSLRQAVVDPLKDFFQRNNAWLLITLIILYKLGDAFA
ASLTTTFLIRGVGFNAGDVGLVNKTLGLLATIIGALYGGVLMQRLSLFRALMIFGVLQAV
SNFGYWLLAVTDKQLWSMASAVFVENLCGGMGTAAFVALLMTLCNKSFSATQFALLSALS
AVGRVYVGPAAGWLVELWGWPTFYAFTVFAGLPGLLLLTFCRHTLNQVEQSGNFLTRSYY
PHGYRWTNRLFAAGCGVLALWLVALALNALGLTALAPLLTRLFELGMTLSLLAVLAGVLL
DYRALKKTPVLPASDA