Protein Info for IAI47_14590 in Pantoea sp. MT58

Annotation: SmdB family multidrug efflux ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 61 to 83 (23 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 277 to 287 (11 residues), see Phobius details PF00664: ABC_membrane" amino acids 31 to 296 (266 residues), 135.1 bits, see alignment E=4e-43 PF00005: ABC_tran" amino acids 357 to 505 (149 residues), 101.5 bits, see alignment E=6.3e-33

Best Hits

Swiss-Prot: 78% identical to MDLB_ECO57: Multidrug resistance-like ATP-binding protein MdlB (mdlB) from Escherichia coli O157:H7

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 97% identity to pva:Pvag_0390)

Predicted SEED Role

"Multidrug resistance-like ATP-binding protein mdlB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>IAI47_14590 SmdB family multidrug efflux ABC transporter permease/ATP-binding protein (Pantoea sp. MT58)
MAKSARLWPTLKRLLSYGKPWRKSLSLAVGMLWIAAAAEVTGPVLVSYFIDNLVAKHQMP
WGIVAGLVVSFILLQLLAAGLHYWQALLFNRAAIGVVQQLRCDVMNAALCQPLSAFDTQP
VGQIISRVTNDTEVIRDLYVTVVSTVLRSAALVGAMMVAMFSLDWRMALVAMMIFPLVLI
VMFIYQRYSTPIARRVRSYLADINNGFNEVISGMSVIQQFRQQARFGERMGEASRSHYLA
RMETLRLDGFLLRPLLSLFSAMVLCGLLILFSFSVPGVFEVGVLYAFITYLGRLNEPLIE
LTTQQSMLQQAVVSGERIFELMDATQQQYGIDPQPLASGRITLNNLSFAYRENRDVLSDI
NLDVAPREFVALVGHTGSGKSTLANLLMGYYPVTRGEIRIDDRPIGDLSHAVLRHGIAMV
QQDPVVLADTLLANVRLGRDISEEAVWQVLQQVQLAPLAQALPEGIHTRLGEQGNNLSVG
QKQLLALARVLVDLPQILILDEATANIDSGTEQAIQQTLATLRQHSTLVVIAHRLSTIVE
ADKILVLHRGRVVEQGTHQQLLAMQGRYWQMYQLQQAGENLASGVPVTSEG