Protein Info for IAI47_14535 in Pantoea sp. MT58

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 55 to 84 (30 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 180 to 210 (31 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 268 (259 residues), 171.9 bits, see alignment E=9.7e-55

Best Hits

Swiss-Prot: 35% identical to MNTC_BACHD: Manganese transport system membrane protein MntC (mntC) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 97% identity to pva:Pvag_0399)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>IAI47_14535 metal ABC transporter permease (Pantoea sp. MT58)
MTLIQPFIEFGFMRRALVACVALAISATPLGVFLSLRRMSLIGDALSHAVLPGAAIGYLI
SGLSLVAMGIGGLIAGLAVALLSGAVSRYTPLKEDASFAGFYLGSLALGVTLVSLRGSSV
DLLHVLFGSLLAVDNAALLLVGGIAAFTLIMLAIIYRPLVIDAFDSDFLRAQGKWSAPLV
HGLFLMLVVLNLVAGFQVLGTLMSVGLMMLPAASARFWSRHLAAMLAIAIFMAMLSALAG
LMLSWHFSLPAGPAVVLSAAMLFFFSILAGPCGGILRRH