Protein Info for IAI47_14480 in Pantoea sp. MT58

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 11 to 179 (169 residues), 235.3 bits, E=2.1e-74
• PF00156: Pribosyltran
  • amino acids 31 to 153 (123 residues), 48.6 bits, E=3e-17

Best Hits

Swiss-Prot: 88% identical to APT_ERWT9: Adenine phosphoribosyltransferase (apt) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 99% identity to pva:Pvag_0410)

MetaCyc: 86% identical to adenine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• (aminomethyl)phosphonate degradation (7/8 steps found)
• superpathway of guanine and guanosine salvage (3/3 steps found)
• adenine and adenosine salvage I (2/2 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenine salvage (2/3 steps found)
• glyphosate degradation III (4/7 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Protein Sequence (183 amino acids)

>IAI47_14480 adenine phosphoribosyltransferase (Pantoea sp. MT58)
MTDTAQQLEFIKNSIKSIPDYPKPGILFRDVTSLLEDPKAYAASIALLVERYRNKGITKV
VGTEARGFLFGAPVALGLGVGFVPVRKPGKLPREVYSEAYELEYGTDQLELHKDAIQPGD
LVLVVDDLLATGGTIEATVKLIRRAGGEVKDAAFIINLFDLTGESRLNALGVESYSLVKF
PGH