Protein Info for IAI47_14365 in Pantoea sp. MT58

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 27 to 174 (148 residues), 111.5 bits, E=2.7e-36

Best Hits

Swiss-Prot: 80% identical to YBBA_ECO57: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli O157:H7

KEGG orthology group: K02003, (no description) (inferred from 100% identity to pva:Pvag_0432)

MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Uncharacterized metabolite ABC transporter in Enterobacteriaceae, ATP-binding protein EC-YbbA"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (6/7 steps found)

Protein Sequence (228 amino acids)

>IAI47_14365 ABC transporter ATP-binding protein (Pantoea sp. MT58)
MPAENIVEVHHLTKSVGQGEHQLTILTGVELVVKPAETIALIGESGSGKSTLLGILAGLD
DGSSGEVHLLGQPLHQMNEEQRAALRARQVGFVFQSFMLVPTLNAQENVQLPSLLRGDSD
RQSREQARELLTLLGLGERLHHLPAQLSGGEQQRVALARAFSGRPGLLFADEPTGNLDRK
TGDRIADLLFSLNRDFATTLILVTHDEQLAARCDRRLRLRDGKLWEEQ