Protein Info for IAI47_14185 in Pantoea sp. MT58

Annotation: DUF1349 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF07081: DUF1349" amino acids 14 to 188 (175 residues), 207.1 bits, see alignment E=1.7e-65 PF17851: GH43_C2" amino acids 60 to 151 (92 residues), 24.9 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 48% identical to REE1_YEAST: Regulation of enolase protein 1 (REE1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K09702, hypothetical protein (inferred from 90% identity to pva:Pvag_0449)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>IAI47_14185 DUF1349 domain-containing protein (Pantoea sp. MT58)
MTAVSSLTTEGGVWINQPPVHSLDGNTLQFETALNSDFWQRTWYGFERHSGHAFGFWVEN
DFTVQVQVRAEFSQLYDQAGLFIQDSETHWVKAGIEFNDDQPAIGSVVTREFSDWSTGVF
PGDARQFWMRATLENAALRIQYSTDGEIWPLLRLCPWPGQGRRFVGVMGCSPEREGLGVS
FMDFALTPPLGKALHDLS