Protein Info for IAI47_14020 in Pantoea sp. MT58

Annotation: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02590: SPOUT_MTase
  • amino acids 1 to 154 (154 residues), 161.5 bits, E=8.3e-52
• TIGR00246: rRNA large subunit m3Psi methyltransferase RlmH
  • amino acids 2 to 156 (155 residues), 271 bits, E=1.5e-85

Best Hits

Swiss-Prot: 95% identical to RLMH_ERWT9: Ribosomal RNA large subunit methyltransferase H (rlmH) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00783, hypothetical protein (inferred from 99% identity to pva:Pvag_0491)

MetaCyc: 92% identical to 23S rRNA m3psi1915 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11592 [EC: 2.1.1.177]

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.177

Protein Sequence (156 amino acids)

>IAI47_14020 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH (Pantoea sp. MT58)
MKLQLVAVGTKMPDWVQTGFMEYLRRFPKDMPFELIEVTAGKRGKNADIKRILEKEGEAM
LAAVGKGNRIVTLDIPGQPWETPQLAQQLERWKLDGRDVSLLIGGPEGLAPACKAAAEQS
WSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE