Protein Info for IAI47_14020 in Pantoea sp. MT58
Annotation: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to RLMH_ERWT9: Ribosomal RNA large subunit methyltransferase H (rlmH) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K00783, hypothetical protein (inferred from 99% identity to pva:Pvag_0491)MetaCyc: 92% identical to 23S rRNA m3psi1915 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11592 [EC: 2.1.1.177]
Predicted SEED Role
"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.1.177
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (156 amino acids)
>IAI47_14020 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH (Pantoea sp. MT58) MKLQLVAVGTKMPDWVQTGFMEYLRRFPKDMPFELIEVTAGKRGKNADIKRILEKEGEAM LAAVGKGNRIVTLDIPGQPWETPQLAQQLERWKLDGRDVSLLIGGPEGLAPACKAAAEQS WSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE