Protein Info for IAI47_13985 in Pantoea sp. MT58

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 18 to 165 (148 residues), 120.1 bits, E=1.1e-38

Best Hits

Swiss-Prot: 89% identical to GLTL_ECOLI: Glutamate/aspartate import ATP-binding protein GltL (gltL) from Escherichia coli (strain K12)

KEGG orthology group: K10004, glutamate/aspartate transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to pva:Pvag_0498)

MetaCyc: 89% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Cystine ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (241 amino acids)

>IAI47_13985 amino acid ABC transporter ATP-binding protein (Pantoea sp. MT58)
MISLKNVSKWYGHFQVLTDCSTEVKTGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGVISV
NGTEVNNKKTNLAQLRSQVGMVFQHFELFPHLSIINNLVLAQVKVLKRDKAAARDKGLKL
LKRVGLSAHAEKFPGQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMV
ELAQEGMTMMVVTHEMGFARKVANRVIFMDEGKIIEDTNKDDFFNNPQSDRAKDFLAKIL
H