Protein Info for IAI47_13880 in Pantoea sp. MT58

Annotation: glucosamine-6-phosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00502: glucosamine-6-phosphate deaminase
  • amino acids 1 to 259 (259 residues), 463.9 bits, E=6.9e-144
• PF01182: Glucosamine_iso
  • amino acids 9 to 232 (224 residues), 78.3 bits, E=4.1e-26

Best Hits

Swiss-Prot: 92% identical to NAGB_ERWT9: Glucosamine-6-phosphate deaminase (nagB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 99% identity to pva:Pvag_0520)

MetaCyc: 86% identical to glucosamine-6-phosphate deaminase (Escherichia coli K-12 substr. MG1655)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (3/8 steps found)
• chitin degradation I (archaea) (1/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Protein Sequence (266 amino acids)

>IAI47_13880 glucosamine-6-phosphate deaminase (Pantoea sp. MT58)
MRLIPLATPTQVGKWAARHIVNRINAFNPTADKPFVLGLPTGGTPLEAYKHLIDMHKAGQ
VSFKHVVTFNMDEYVGLPKEHPESYHSFMYRNFFDHVDIQPENINLLNGNAPDIDAECRQ
YEEKIRTLGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFNGDVDQ
VPKYALTVGVGTLLDAEEVMILVTGHVKAQALQAAVEGNVNHMWTISCLQLHAKSVVVCD
EPATMELKVKTVKYFREMEAENMKGV