Protein Info for IAI47_13875 in Pantoea sp. MT58

Annotation: PTS transporter subunit EIIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 333 to 350 (18 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 1 to 490 (490 residues), 672.4 bits, see alignment E=5.4e-206 PF02378: PTS_EIIC" amino acids 10 to 322 (313 residues), 237.6 bits, see alignment E=3e-74 TIGR00826: PTS system, glucose-like IIB component" amino acids 381 to 479 (99 residues), 70.5 bits, see alignment E=1.8e-23 PF00367: PTS_EIIB" amino acids 423 to 454 (32 residues), 47.3 bits, see alignment (E = 1.7e-16) PF00358: PTS_EIIA_1" amino acids 527 to 651 (125 residues), 153 bits, see alignment E=4.8e-49 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 528 to 648 (121 residues), 151.2 bits, see alignment E=1.9e-48

Best Hits

KEGG orthology group: K02802, PTS system, N-acetylglucosamine-specific IIA component [EC: 2.7.1.69] K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 96% identity to pva:Pvag_0521)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component (EC 2.7.1.69)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (675 amino acids)

>IAI47_13875 PTS transporter subunit EIIC (Pantoea sp. MT58)
MLGYLQKVGRALMVPVATLPAAAILMGVGYWIDPDSWGAGNALAALLIKSGSAIIEHMSV
LFAIGIAYGMSKDKDGAAALTGFVGFLVVTTLCSPAAVAMIQKIPLAQVPAAFGKIENQF
VGILVGILSAEVYNRFSHVELPKALSFFSGRRLVPILVSFLMIFVAFILMYIWPVVFNGL
VSFGEHIQKLGSVGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPKFLGGAQSLAD
GTATVGITGRYQAGFFPIMMFGLPGAALAIYHCARPENRVKVGSIMLAAAFAAFFTGITE
PLEFSFMFVAPVLYLIHAVLTGLSVFIAASMHWIAGFGFSAGLVDMVLSTRNPLATHWYM
LIPQGLVFFAIYYVVFRFTIKKFNLMTPGRELAVDGDESDGYDVNVDKTDNGETATESLA
RRYIGAVGGSENLTSIDACITRLRLNVNDSAQVNEGVAKRLGASGVIRLNKQSVQIIVGT
QAESIASAMKKVLTKGPVAAATASSAPAEPAVAPQAVLNSEKRVIATLLAPVSGEVVALD
DVPDEAFASKAVGDGLAIKPSDKWVVAPIAGTLVKIFNTNHAFCLETENGVEIVVHMGLD
TVALEGKGFTRLAEEGASVVAGQRVLEMDLEFLNANARSMVSPVVVSNSDDFAGLTLLAR
GQVVAGETPLYEVKG