Protein Info for IAI47_13805 in Pantoea sp. MT58

Annotation: 5-oxoprolinase subunit PxpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02682: CT_C_D
  • amino acids 6 to 202 (197 residues), 249.2 bits, E=1.5e-78
• TIGR00370: sensor histidine kinase inhibitor, KipI family
  • amino acids 9 to 211 (203 residues), 309.3 bits, E=4.8e-97

Best Hits

Swiss-Prot: 73% identical to PXPB_ECO57: 5-oxoprolinase subunit B (pxpB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to pva:Pvag_0536)

MetaCyc: 73% identical to 5-oxoprolinase component B (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• 5-oxo-L-proline metabolism (6/6 steps found)
• uracil degradation III (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• γ-glutamyl cycle (5/6 steps found)
• cyanuric acid degradation II (4/5 steps found)
• cyanate degradation (2/3 steps found)
• cyanuric acid degradation I (3/5 steps found)
• superpathway of allantoin degradation in yeast (3/6 steps found)
• superpathway of atrazine degradation (4/8 steps found)
• allantoin degradation IV (anaerobic) (3/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Glutathione metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54 or 3.5.2.9

Protein Sequence (218 amino acids)

>IAI47_13805 5-oxoprolinase subunit PxpB (Pantoea sp. MT58)
MQRARCYLLGERAVVLELEPPVSLESQQRIWGLNQRLQSSASVLEVIPGMNNITLILRDP
QQSALDAIERLQRWWEESEAQLPESRLVEIPVIYGGEAGPDLTAVAEHAALTPHQVVELH
SSSEYVVFFIGFQPGFPYLGGLDPRLHIPRRSEPRVAVPAGSVGIGGSQTGVYPLASPGG
WQLIGQTRTALFDPLQQPPTLLRPGDKVRFVPQQEGVC