Protein Info for IAI47_13785 in Pantoea sp. MT58

Annotation: DUF979 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details amino acids 230 to 267 (38 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF06166: DUF979" amino acids 6 to 337 (332 residues), 391.4 bits, see alignment E=1.5e-121

Best Hits

KEGG orthology group: None (inferred from 95% identity to pva:Pvag_0540)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>IAI47_13785 DUF979 domain-containing protein (Pantoea sp. MT58)
MFQQQYLMWLAGIILLVVAILSWRDRANPRRFTTGLFWALYGLVFLVGDWTTVLMSSLMG
SDAAGTRMLHITIGVIVVIMALIAGLGGVRLGRYHQRTNEEKQASAQRLRNKLFLPALAI
PVVTVVGVLAFNNIPGLQDAVFGPGNHATLVTLFSMMAGCVIGWLVALKLTHEKPVQSMQ
ETRRLLDSIGWAFILPQILATLGLLFTAAGVGSAISHLTETWLAVDNRFIAVTVYAVGMA
LLTMVMGNAFAAFPIITAGVGIPILVLQHGGNPAVMAAIGMFSGYCGTLMTPMAANFNIV
PAALLELPDRNAVIKAQIPTGVLLLIVNIFLLYFLMFL