Protein Info for IAI47_13765 in Pantoea sp. MT58

Annotation: succinate dehydrogenase cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 6 to 123 (118 residues), 106 bits, E=7.4e-35
• TIGR02970: succinate dehydrogenase, cytochrome b556 subunit
  • amino acids 7 to 126 (120 residues), 130.8 bits, E=1.5e-42

Best Hits

Swiss-Prot: 80% identical to DHSC_SALTI: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Salmonella typhi

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 98% identity to pva:Pvag_0544)

MetaCyc: 79% identical to succinate:quinone oxidoreductase, membrane protein SdhC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Protein Sequence (129 amino acids)

>IAI47_13765 succinate dehydrogenase cytochrome b556 subunit (Pantoea sp. MT58)
MGKTVKKQRPVNLDLSTIRFPVTAITSILHRVSGVITLVAIGILLWLLGLSLSSPEGFQH
AASIMDGFFAKFIMWGILTALAYHAVSGIRHMLMDFGYLAETLESGKRSAHMTFVITVVL
AILAGVLVW