Protein Info for IAI47_13760 in Pantoea sp. MT58

Annotation: succinate dehydrogenase membrane anchor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein
  • amino acids 10 to 113 (104 residues), 116.3 bits, E=3.5e-38

Best Hits

Swiss-Prot: 74% identical to DHSD_SHIFL: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Shigella flexneri

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 98% identity to pva:Pvag_0545)

MetaCyc: 74% identical to succinate:quinone oxidoreductase, membrane protein SdhD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Protein Sequence (115 amino acids)

>IAI47_13760 succinate dehydrogenase membrane anchor subunit (Pantoea sp. MT58)
MVSNASALGRNGIQDWLLLRATAILITLYIVYILGFVVMTDTLTYDLWRGFFASAFTKVF
TLLTLFSILVHGWIGMWQVLTDYVKSLPVRLLLQFVIVVALLWYAIYGFVVVWGV