Protein Info for IAI47_13710 in Pantoea sp. MT58

Annotation: cyd operon protein YbgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 49 to 66 (18 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details TIGR02112: cyd operon protein YbgE" amino acids 5 to 95 (91 residues), 115.7 bits, see alignment E=5.9e-38 PF09600: Cyd_oper_YbgE" amino acids 17 to 94 (78 residues), 106.1 bits, see alignment E=5.1e-35

Best Hits

Swiss-Prot: 55% identical to YBGE_ECOLI: Uncharacterized protein YbgE (ybgE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to pva:Pvag_0555)

Predicted SEED Role

"Cyd operon protein YbgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (97 amino acids)

>IAI47_13710 cyd operon protein YbgE (Pantoea sp. MT58)
MRTPIRMLYDLMDKGPLRALSLLLALLAAGGVMWDPTRFANHAGQLPALQGLVLIWAVCS
GVIHGTGFRPQQTRWQALFSPLPAMLVLFIALYRFYL