Protein Info for IAI47_13685 in Pantoea sp. MT58

Annotation: Tol-Pal system protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 16 to 428 (413 residues), 508.5 bits, see alignment E=7.4e-157 PF04052: TolB_N" amino acids 24 to 122 (99 residues), 112.6 bits, see alignment E=1.9e-36 PF07676: PD40" amino acids 200 to 225 (26 residues), 22.5 bits, see alignment (E = 1.7e-08) amino acids 238 to 273 (36 residues), 36 bits, see alignment 1e-12 amino acids 282 to 317 (36 residues), 42.2 bits, see alignment 1.1e-14 amino acids 373 to 400 (28 residues), 15.3 bits, see alignment (E = 3.1e-06) PF00930: DPPIV_N" amino acids 250 to 350 (101 residues), 30.5 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 87% identical to TOLB_SALTY: Tol-Pal system protein TolB (tolB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03641, TolB protein (inferred from 99% identity to pva:Pvag_0560)

MetaCyc: 87% identical to Tol-Pal system periplasmic protein TolB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>IAI47_13685 Tol-Pal system protein TolB (Pantoea sp. MT58)
MKQALRVTLGFFILLWAAMLHAEVRIEITQGVNTARPIGVVPFKWAGSGAAPEDVGGIVA
ADLRNSGKFNPLDRSRLPQQPTSAQEVQPAAWSALGIDAVVVGQVASNPDGSYQVSYQLV
DTGGAPGTVLAQNSYKVTKQWLRYAAHTASDETFQKLTGIKGAFRTRIAYVVQTNGGQFP
YELRVADYDGYNQFVVHRSPQPLMSPAWSPDGSKVAYVTFESGKSALVVQTLSNGAIRQV
ASYPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQTRQVTDGRYNSTEPTWFPDS
QTLAYTSDQAGAPQIYKVGINGGTPQRITWEGGQNQDADVATDGKSMVMISTNGGAQHVA
KQDLETGAVQTLTDTFLDETPSLAPNGTMVIYSSTQGMGSVLQLVSTDGRFKARLPATDG
QVKFPAWSPYL