Protein Info for IAI47_13645 in Pantoea sp. MT58

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF02805: Ada_Zn_binding" amino acids 8 to 70 (63 residues), 99 bits, see alignment E=2.5e-32 PF12833: HTH_18" amino acids 106 to 184 (79 residues), 80.8 bits, see alignment E=1.5e-26 PF06029: AlkA_N" amino acids 199 to 316 (118 residues), 139.8 bits, see alignment E=9.7e-45

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 97% identity to pva:Pvag_0566)

Predicted SEED Role

"ADA regulatory protein" in subsystem DNA repair, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>IAI47_13645 helix-turn-helix domain-containing protein (Pantoea sp. MT58)
MLDPDIAYQALTSRDTRFDGVFFVGVTSTGIYCRPICPVKAPMQKNCLFFSSAEAAEKAR
FRPCLRCRPELAPGNAPVDQPHRVAEQLIQRIEEGMLEEREGLEAIAAEFSLSLRQLRRI
VQHELGVSPLELKQTRRMLLAKQLLTETQLPVTEVAYASGFSSLRRFNDVFQARYRMTPS
ALRREDTGAKRAQPGDRVTLRLAYRPPYDWAAMLWFLQTHLMKEVEAVEDGCWRRTVALG
RYRGWVSVSHLPQKNALQVTLSTSLTPVLPLLLRRLRDLFDLDAQPQRIATCLAQDPLLA
PSLIAHPGLRVPGAFDAFELGVRAIIGQQVTVKAATTVSSRFAAAFGEPCETPFADLTRY
TALPERIAALTVDDVAPMGIVSAARSRAIIAFATACASGDLRLSAAQPPDEVIKKLVSLP
GIGPWTAHYIAMRALRWPDAFPKEDIAIRNNLGGMSSKEAEARSQSWRPWRSYAVMHIWE
SLAVAKVKKKP