Protein Info for IAI47_13625 in Pantoea sp. MT58

Annotation: CDF family zinc transporter ZitB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 14 to 289 (276 residues), 311.3 bits, see alignment E=3e-97 PF01545: Cation_efflux" amino acids 18 to 209 (192 residues), 169.1 bits, see alignment E=5.3e-54

Best Hits

Swiss-Prot: 70% identical to ZITB_ECO57: Zinc transporter ZitB (zitB) from Escherichia coli O157:H7

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 93% identity to pva:Pvag_0571)

MetaCyc: 70% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Zinc transporter ZitB" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>IAI47_13625 CDF family zinc transporter ZitB (Pantoea sp. MT58)
MAHTHTHSGQDSNRTRLAAAFGVTVVFMVAEVIGGWLSGSLALLADAGHMLTDAAALLMA
LLAVHFSRRKPNARHTFGLLRLTTVAAFINAIALLGITALIVWEAVRRFADPQPVTGGLM
LGIAIGGLLANLLSFWLLHHGSGEKNLNVRAAALHVMGDLLGSVGAIVAAVIIMLTGWTP
IDPILSLLVSLLVLRSAWSLLRESLQELLEGAPHSLDVNKLTRDLTLNIAEVRNVHHVHL
WQVGEKPMLTLHAQVIPPYDHDALLHRIHDYLRENYQIAHATVQMEYQPCAGAECELGSG
SAAATGHDHSHSHDHDHDHVKGDKHTH