Protein Info for IAI47_13600 in Pantoea sp. MT58

Annotation: 2,3-diphosphoglycerate-dependent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01258: phosphoglycerate mutase 1 family
  • amino acids 5 to 248 (244 residues), 423.3 bits, E=1.4e-131
• PF00300: His_Phos_1
  • amino acids 6 to 125 (120 residues), 102.5 bits, E=1.2e-33

Best Hits

Swiss-Prot: 92% identical to GPMA_ERWT9: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to pva:Pvag_0576)

MetaCyc: 89% identical to 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Escherichia coli K-12 substr. MG1655)
RXN-15513 [EC: 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• Bifidobacterium shunt (14/15 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• gluconeogenesis I (12/13 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• Rubisco shunt (9/10 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• glycolysis IV (8/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• glycerol degradation to butanol (11/16 steps found)
• photorespiration II (6/10 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11

Protein Sequence (250 amino acids)

>IAI47_13600 2,3-diphosphoglycerate-dependent phosphoglycerate mutase (Pantoea sp. MT58)
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRGEAKSAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKTWRLNERHYGALQGLDKAETAAKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYAKLTPEQLPTTESLALTIDRVIPYWNDTILPRIKSGEKVI
IAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPLKRYYLGDQDEIAAKA
AAVANQGKAK