Protein Info for IAI47_13570 in Pantoea sp. MT58
Annotation: multidrug efflux pump-associated protein, AcrZ family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to ACRZ_ECOL6: Multidrug efflux pump accessory protein AcrZ (acrZ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 74% identity to pam:PANA_1206)Predicted SEED Role
"FIG01200701: possible membrane protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (51 amino acids)
>IAI47_13570 multidrug efflux pump-associated protein, AcrZ family (Pantoea sp. MT58) MLELLKSLAFAVLMVPVVMALMLGMIYGLGEVFNVISKIGHREKSSARSHN