Protein Info for IAI47_13475 in Pantoea sp. MT58

Annotation: molybdopterin synthase catalytic subunit MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 10 to 120 (111 residues), 133.7 bits, E=1.7e-43

Best Hits

Swiss-Prot: 82% identical to MOAE_SALTY: Molybdopterin synthase catalytic subunit (moaE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 97% identity to pva:Pvag_0601)

MetaCyc: 80% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Protein Sequence (150 amino acids)

>IAI47_13475 molybdopterin synthase catalytic subunit MoaE (Pantoea sp. MT58)
METQIRVGPAPFDMAEAYRWLAACDEDGAVVTFTGKVRNHNLGDNVAALMLEHYPGMTEK
ALQEIVDAARERWPLQRVTVIHRVGELFPGDEIVLVGVTSAHRSSAFSAAEFIMDYLKTR
APFWKREATEQGDRWVDARDSDHQAAQRWD