Protein Info for IAI47_13455 in Pantoea sp. MT58

Annotation: UPF0104 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 236 to 266 (31 residues), see Phobius details amino acids 277 to 303 (27 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 21 to 295 (275 residues), 60.9 bits, see alignment E=7.4e-21

Best Hits

Swiss-Prot: 73% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 99% identity to pva:Pvag_0605)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>IAI47_13455 UPF0104 family protein (Pantoea sp. MT58)
MAKKHPRWQLAKKILTVLFFIAVVVLLVVYARKVNWEDVYNVIVNYNRFVVLTAAGLVVL
SYLVYGCYDLIGRAYCGHKLAKRQVMLVSFICYAFNLTLSTWVGGVAMRYRLYSRLGLDS
GTITRIFSLSIATNWLGYILLAGVVFSAGMVSIPSGWFIGETTLRLIGGVLLVLVAIYLW
ACAFSKQRRWTIKGQTLQLPSLRMALLQFAVSCANWMVMGAIIWLLLGRDVGYPMVLGVL
LISSIAGVIIHIPAGIGVLEAVFLALLSGQHASHGTIIAALLAYRVLYFILPLLLALVLY
LGLESRAKHLRQKNEQKLQKSS