Protein Info for IAI47_13440 in Pantoea sp. MT58

Annotation: YbhQ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details PF11076: YbhQ" amino acids 1 to 124 (124 residues), 202.5 bits, see alignment E=1.1e-64

Best Hits

Swiss-Prot: 52% identical to YBHQ_SHIFL: Inner membrane protein YbhQ (ybhQ) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_0608)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>IAI47_13440 YbhQ family protein (Pantoea sp. MT58)
MKWSNRIQIITGQTLLHIAMHLLVIAALIWGWKHKALVDVCSTLVAMYALVFVAMLVTQR
IPRLRTLGDYLEEATTTYYFGAAMMTLFLVSRIYHNNLLLACLGVVMLLGPALVSLLAKE
PPRRIENKRS