Protein Info for IAI47_13235 in Pantoea sp. MT58

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 117 (105 residues), 72.8 bits, see alignment E=1.4e-24 PF00528: BPD_transp_1" amino acids 37 to 223 (187 residues), 65.7 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 54% identical to OCCM_RHIRD: Octopine transport system permease protein OccM (occM) from Rhizobium radiobacter

KEGG orthology group: K10019, octopine/nopaline transport system permease protein (inferred from 98% identity to pva:Pvag_0653)

Predicted SEED Role

"ABC-type arginine/histidine transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>IAI47_13235 ABC transporter permease subunit (Pantoea sp. MT58)
MIDFAFLTDTFLKLSAALPVTLGLFISAFLCGGVLAVGILALRMSRWRLLSAFARGYILV
FRGSPLMIQLFLIYYGLGQFGVIRHSVFWPFLREPFTCAVLALSLCTAAYTAEILRGALL
AVPPGQVEAGMACGMSRGLLLRRIIAPVMLRYALPAYSTEAILLVKSTALASLVTVWDVT
GVAQQIIQRTYRTMEVFLCAAAIYLILNFIIVQLYALLERRLTPVHKPEKKPLPAAKPIP
GGEKNV