Protein Info for IAI47_13230 in Pantoea sp. MT58

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00005: ABC_tran" amino acids 24 to 183 (160 residues), 122.6 bits, see alignment E=1.9e-39 PF13304: AAA_21" amino acids 146 to 213 (68 residues), 33.4 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 62% identical to NOCP_AGRFC: Nopaline permease ATP-binding protein P (nocP) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10021, octopine/nopaline transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to pva:Pvag_0654)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>IAI47_13230 ATP-binding cassette domain-containing protein (Pantoea sp. MT58)
MSELPPVTLSASDIHKSFGAMEVLKGISLQAHQGDVISILGASGSGKSTLLRCINLLETP
DSGVVSVGGETIEMKRHARGHQLAANPRQIERLRSRLGMVFQSFNLWSHLTVLQNVIEGP
HYVLKRDKKACIAQAEQLLDRVGLLNRKDFYPAQLSGGQQQRVAIARALAMDPEVMLFDE
PTSALDPELVGEVLKVMRSLAEEGRTMLVVTHEMGFARNVSNRVVFMHQGTIDCQGTPEA
MFGEAGSARFKQFISSHHQVEPVV