Protein Info for IAI47_13170 in Pantoea sp. MT58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 44 to 63 (20 residues), see Phobius details PF16576: HlyD_D23" amino acids 76 to 326 (251 residues), 54.8 bits, see alignment E=2.1e-18 PF13533: Biotin_lipoyl_2" amino acids 81 to 127 (47 residues), 57.6 bits, see alignment 2e-19 PF00529: CusB_dom_1" amino acids 86 to 373 (288 residues), 30.9 bits, see alignment E=5.4e-11 PF13437: HlyD_3" amino acids 253 to 337 (85 residues), 49.7 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 97% identity to pva:Pvag_0667)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>IAI47_13170 HlyD family secretion protein (Pantoea sp. MT58)
MSENNQRDPHQQDAENTTDQNRQSEENQDNDQQPERKRPGKKPLIILAVVVVIMLIVGLW
FWLSTRNIETTDDAFTEGDAVTIAPKASGYVVKLLVKDNQRVKKGDLLVEIDPSDNRAQR
EQANAQLGLAVAQLHQAQAQLALSKVQYPAQRDQALADQAKAEANMLNAQADYRRQRGVD
PRATSQRNIDSASAQLRSAQAQLQSAKAQVEVASQVALQIRQQETNVEARQQQVEQAKAQ
LSTADLNLSYTQVRAPYDGFITKRNVQLGTLVQAGSSLFSLVSPDIWVTANFKESQLERM
NPGDKVKISVDAWPDMKLEGHVDSIQMGSGSRFSTFPSENATGNYVKIVQRVPVKIVIDK
GLDPNHPLPLGLSVEPEVTVE