Protein Info for IAI47_13085 in Pantoea sp. MT58

Annotation: undecaprenyl-diphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01569: PAP2
  • amino acids 66 to 170 (105 residues), 49.1 bits, E=2.5e-17

Best Hits

Swiss-Prot: 60% identical to YBJG_ECOLI: Putative undecaprenyl-diphosphatase YbjG (ybjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_0686)

MetaCyc: 60% identical to undecaprenyl pyrophosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Undecaprenyl-diphosphatase. [EC: 3.6.1.27]

Predicted SEED Role

"Putative permease"

MetaCyc Pathways

• polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
• di-trans,poly-cis-undecaprenyl phosphate biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Protein Sequence (201 amino acids)

>IAI47_13085 undecaprenyl-diphosphate phosphatase (Pantoea sp. MT58)
MEELNHSLFTAINATPASPAWLIHLATFIAKDLIAIVPLLIVAMWLWGPRDQVSSQRALV
LKTGMALIYALAISWCVGHLLPHPRPFAIGYGYQFLHHAADDSYPSDHGTTIFTFALAFI
FWHRLWSGVVLMIGGCAIAWSRVYLGVHWPMDMLGGFLVGLLSCLASHLAWQFYGERMLA
VINPLYRALFAVPIRKGWTQD