Protein Info for IAI47_13060 in Pantoea sp. MT58

Annotation: oxygen-insensitive NADPH nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 11 to 159 (149 residues), 68.1 bits, E=5.4e-23

Best Hits

Swiss-Prot: 72% identical to NFSA_ECOLI: Oxygen-insensitive NADPH nitroreductase (nfsA) from Escherichia coli (strain K12)

KEGG orthology group: K10678, nitroreductase [EC: 1.-.-.-] (inferred from 99% identity to pva:Pvag_0693)

MetaCyc: 72% identical to NADPH-dependent nitro/quinone reductase NfsA (Escherichia coli K-12 substr. MG1655)
R303-RXN [EC: 1.7.1.16]; RXN0-7385 [EC: 1.7.1.16, 1.6.5.10]

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.6.5.10 or 1.7.1.16

Protein Sequence (240 amino acids)

>IAI47_13060 oxygen-insensitive NADPH nitroreductase (Pantoea sp. MT58)
MTPTIDLLCSHRSIRAFTDQPVSEEQREAIINSAQSASTSSFLQCSSIIRITDKALRDKL
VTLTGGQTWVADAPEFWIFCADFNRHLQICPDAQLGRAEQLLLGCVDTALMGQNAMVAAE
SLDLGGVFIGGIRNSIAEVTELLGLPKFVLPLFGFCLGHPESKPDVKPRMPHAMLVHENR
YQPLDPAVLAEYDSRTELYYQQRDSNQRSETWSELIQRLIIKETRPFMLDYLHQQGWATR