Protein Info for IAI47_12900 in Pantoea sp. MT58

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF05496: RuvB_N" amino acids 20 to 138 (119 residues), 52.7 bits, see alignment E=1.6e-17 PF07728: AAA_5" amino acids 53 to 156 (104 residues), 27.6 bits, see alignment E=9.3e-10 PF00004: AAA" amino acids 53 to 159 (107 residues), 65.9 bits, see alignment E=1.8e-21 PF16193: AAA_assoc_2" amino acids 187 to 267 (81 residues), 85 bits, see alignment E=1.2e-27 PF12002: MgsA_C" amino acids 268 to 434 (167 residues), 212.9 bits, see alignment E=9.6e-67

Best Hits

Swiss-Prot: 89% identical to RARA_ECOL6: Replication-associated recombination protein A (rarA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07478, putative ATPase (inferred from 98% identity to pva:Pvag_0727)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>IAI47_12900 replication-associated recombination protein A (Pantoea sp. MT58)
MSNLSLDFSTENFKPLAARMRPETLKQYIGQQHLLGAGKPLPRAIEAGHLHSMILWGPPG
TGKTTLAEIIAHYGNADVERISAVTSGVKEIREAIERARQNKHAGRRTILFVDEVHRFNK
SQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARVYLLKSLTLEDIEQVLDQAMQD
KARGYGESDIVLPDNTRRMIAELVNGDARRALNTLEMMADMAETTASGQRELTPQLLNEV
SGERSARFDNKGDRFYDLISALHKSVRGSAPDAALYWYARIITAGGDPLYVARRLLAIAS
EDVGNADPRGMQVAIAAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYNAFKAAMRDA
RDNPDYDVPEHLRNAPTKLMKEMGLGKEYRYAHDETNAYAAGEVYFPKELASTRYYTPTQ
RGLEGKIGEKLSWLAEQDQNSPTKRYR