Protein Info for IAI47_12835 in Pantoea sp. MT58

Annotation: lipid A ABC transporter ATP-binding protein/permease MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 63 to 94 (32 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 12 to 581 (570 residues), 878.1 bits, see alignment E=1.3e-268 PF00664: ABC_membrane" amino acids 28 to 298 (271 residues), 204.6 bits, see alignment E=3.8e-64 PF00005: ABC_tran" amino acids 359 to 509 (151 residues), 122.2 bits, see alignment E=4e-39

Best Hits

Swiss-Prot: 88% identical to MSBA_ECOUT: Lipid A export ATP-binding/permease protein MsbA (msbA) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 99% identity to pva:Pvag_0740)

MetaCyc: 87% identical to ATP-binding lipopolysaccharide transport protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-236 [EC: 7.5.2.6]; 7.5.2.6 [EC: 7.5.2.6]

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>IAI47_12835 lipid A ABC transporter ATP-binding protein/permease MsbA (Pantoea sp. MT58)
MHQDKDLSTWQTFRRLWPMIAPNKAGLIAASVALIINAAGDALMLSLLKPLLDDGFGKAD
RSVMLWLPLVVIGLMLVRGVTSYISSYCISWVSGNVVMNIRRRLFSHMMGMPVSFFDQQS
TGTLLSRITYDSEQVASSSSGALVTVVREGASIIGLFVMMFYYSWQLSLILIVLAPIVSF
AIRTVSKRFRTISKSMQNTMGQVTTSAEQMLKGHKEVLIFGGQEIESERFSRVSNRMRQQ
GMKLVSASSISDPIIQLIASLALAFVLYAASFPSVMDTLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFSILDSEQEVDNGTREMTRAKGDIEFRDVTFTYPGRDIPALR
NINLSLPAGKTVALVGRSGSGKSTMASLLTRFYDIQQGEILLDGHDLREYSLRSLRNQVA
LVSQNVHLFNDTIANNIAYARSEQYSRAEIEQAATMAHAMDFINKMDKGLDTVIGENGVL
LSGGQRQRIAIARALLRDCPILILDEATSALDTESERAIQSALDELQKNRTSLVIAHRLS
TIEKADEIVVIEDGQIVERGTHQVLLAERGAYAQLHKMQFGQ