Protein Info for IAI47_12760 in Pantoea sp. MT58

Annotation: porin OmpF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13609: Porin_4" amino acids 12 to 350 (339 residues), 68 bits, see alignment E=1.3e-22 PF00267: Porin_1" amino acids 27 to 373 (347 residues), 467.6 bits, see alignment E=3.1e-144

Best Hits

Swiss-Prot: 69% identical to OMPF_ECOLI: Outer membrane porin F (ompF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to pva:Pvag_0755)

MetaCyc: 69% identical to outer membrane porin F (Escherichia coli K-12 substr. MG1655)
RXN0-2481; RXN0-7199; RXN0-7200; RXN0-7201; RXN0-7202; RXN0-7203; RXN0-7204; RXN0-7206; RXN0-7207; RXN0-7208; RXN0-7209; RXN0-7210; RXN0-7211; RXN0-7241; RXN0-7242; RXN0-7243; RXN0-7244; RXN0-7245; RXN0-7246; RXN0-7247; TRANS-RXN-380; TRANS-RXN0-490; TRANS-RXN0-598; TRANS-RXN0-601; TRANS-RXN0-603; TRANS-RXN0-604; TRANS-RXN0-606; TRANS-RXN0-607; TRANS-RXN0-608; TRANS-RXN0-609; TRANS-RXN0-611; TRANS-RXN0-612; TRANS-RXN0-614; TRANS-RXN0-615

Predicted SEED Role

"Outer membrane protein C precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>IAI47_12760 porin OmpF (Pantoea sp. MT58)
MKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKAVGLHYFSDNDGSDGDGNNGDKS
YVRFGFKGETQINDQLTGYGQWEYNIQANNSEGSDAQNGNKTRLGFAGLKFGDAGSIDYG
RNYGVVYDAIGWTDMLPEFGGDSGYSDNFMNGRSTGLLTYRNTNFFGLVDGWDFALQYQG
KNERTDTRRANGDGWGASTSYTSPIGVGVVGAYSSSDRTNSQADGTTDINGNVVGQGKRA
ENWATALKYDANNVYLAAMYGETRNSTPISVVTGLNNTTSAASANKAQNIELVAQYQFDF
GLRPSIAYVQSKGKDIEGVGDADLIKYIDVGATYYFNKNMSTYVDYQINQLDDNNALGLN
TDDTVAVGLVYQF