Protein Info for IAI47_12710 in Pantoea sp. MT58

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 9 to 33 (25 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 221 to 231 (11 residues), see Phobius details amino acids 237 to 244 (8 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 12 to 279 (268 residues), 124.8 bits, see alignment E=6.8e-40 PF13440: Polysacc_synt_3" amino acids 34 to 328 (295 residues), 48.3 bits, see alignment E=1.3e-16 PF14667: Polysacc_synt_C" amino acids 331 to 412 (82 residues), 34.3 bits, see alignment E=3.7e-12

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 99% identity to pva:Pvag_0765)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>IAI47_12710 flippase (Pantoea sp. MT58)
MAKVLDKSLIINIFSLLAYRGASFLFPLATLPYLARVLGVEQMGTLALAIACVLYCSTIS
DWGFNVFTTKDIAHHRDDKERVTQLFWSTFNAKLMLLVVTSGTLLTATWFNPAWHPLFFI
ILANCTTLIGSLFSFGWLMQGFEKLGKTAMIATFGNFCAIPLTFLLVKSPQDTWLAALIP
GTVSIISAAITLKFVLEMKVIGRYRFEPREIKQRITDSMDVFIAIAGANLFNSVNVVILA
SFTSTYMVGIYNGADRLRKAANSVPEQIGSAFFPRVSHLFGRDKRAAIAATRKSLLLSFS
LSLSIVIFTWFFADLVVSILLGKDFIPSADVLRVFVLCFLFGNIAYPAGLQILIPHGLAR
QRMWVMMAAGVINVPLCCFLAWKFGAIGAAWSMVGAEAFVCIGIFGIMQRHGILREYLFP
SQVENRPVNDSAA