Protein Info for IAI47_12680 in Pantoea sp. MT58

Annotation: membrane integrity-associated transporter subunit PqiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 304 to 328 (25 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 2 to 408 (407 residues), 516.6 bits, see alignment E=2.6e-159 PF04403: PqiA" amino acids 50 to 200 (151 residues), 128 bits, see alignment E=1.5e-41 amino acids 253 to 409 (157 residues), 181.1 bits, see alignment E=7e-58

Best Hits

Swiss-Prot: 68% identical to PQIA_ECOLI: Intermembrane transport protein PqiA (pqiA) from Escherichia coli (strain K12)

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 97% identity to pva:Pvag_0772)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>IAI47_12680 membrane integrity-associated transporter subunit PqiA (Pantoea sp. MT58)
MCSAVKSNAWILCPQCDLMIKLPDIPVGSRASCPRCHTSLTANWHEPRKRPTGYALAALF
MLLLANLFPFVSMKVAGLTSQITLSQIPKVMVTEDYSSLATLFLLFVQAVPAFCMITIIL
LVNPVPFPTRLKIGLARILFQLRNWGMAEIFMAGVLVSFVKLMAYGEIGLETSFWPWVLF
CLLQLRAFQCVDRRELWESLSPRPALPHLPEVGISGLEQGLRSCPCCTAILPEAEHTCPR
CGVTAQARRKHSLQWTLALLFTSILLYIPANLLPIMVTETLGTAYPSNIMAGVIVLWDDG
SYPVALVIFIASIMVPTLKMLAIGWLCWDASGRGRRDSHRMHKIYEVVEFVGRWSMIDVF
VIAVLSALVRMGQLMNVYPAWGAVLFAMVVIITMIAAMTFDPRLTWDRVRENNMKESRLD
GN