Protein Info for IAI47_12630 in Pantoea sp. MT58

Annotation: TIGR01666 family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 426 to 441 (16 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 474 to 490 (17 residues), see Phobius details amino acids 497 to 513 (17 residues), see Phobius details amino acids 519 to 541 (23 residues), see Phobius details TIGR01666: TIGR01666 family membrane protein" amino acids 18 to 714 (697 residues), 980.3 bits, see alignment E=5.1e-299 TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 18 to 714 (697 residues), 892.8 bits, see alignment E=1.4e-272 PF12805: FUSC-like" amino acids 75 to 353 (279 residues), 335.5 bits, see alignment E=2.3e-104 PF13515: FUSC_2" amino acids 416 to 535 (120 residues), 93.2 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 65% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_0782)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (719 amino acids)

>IAI47_12630 TIGR01666 family membrane protein (Pantoea sp. MT58)
MPAAINMMSDAVPGWRKYLFNSTWRYLLRILFALSGCAAIPWWLHQIEWTIPLTLGVVAA
ALADLDDRLAGRLKNLLITLLCFCIASVSVELLFPYPFAFIVGLAISTWGFILLGALGQR
YATIAFGALLIAVYTMLGIGLFSQWYMQPMLLLVGALWYNLLTLLGHLMFPVRPVQEQLA
GSFSQLARYLDAKGNLFDPDAGEQDDAAFIDAAMVNSQLVAQLNLTKTTLQSRLRGDRGS
RGTRRSLHYYFVAQDIHERASSSHLQYHLLRGDWRYNEILFRFQRLLNMQAQACRQLAHC
ILMRERWVHDSRFERAFERLQKAIERLEQREPEAEHTRALFWLLRNLRAIDAHLASIESE
QTLAGEDPQHSDNLLSREGLSGWSDIRLRFSRHLSPSSALFRHAVRMSVVLCIGYGFIKI
TGLERGYWILLTSLFVCQPNYNATQRRLALRIGGTLAGIAIGLPVLWLVPSIEGQLILIV
ISGVLFFAFRQVQYAQATLFITLLVLLCFNLLGEGFEVALPRVVDTLLGCGLAWLAVAFI
WPDWRFRQLPAVAERTLKANCRYLDAIMEQYHQGKDNRLAYRIARRDAHNADAELASVVS
NMSSESRTSQKLRESAFQLLCSNHSFLSYISALGAHRDKITAPELLTLLDDTVCYVEDVL
QTDVVSDEHVETMRHQLAHRISQLAADADVRAPLVLQQLGLLVALMPDVARLRRTLIAD