Protein Info for IAI47_12535 in Pantoea sp. MT58

Annotation: pyrimidine utilization transport protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 76 (17 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 399 to 401 (3 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details TIGR03616: pyrimidine utilization transport protein G" amino acids 1 to 428 (428 residues), 793.7 bits, see alignment E=3.8e-243 TIGR00801: uracil-xanthine permease" amino acids 28 to 424 (397 residues), 373.4 bits, see alignment E=1.5e-115 PF00860: Xan_ur_permease" amino acids 30 to 401 (372 residues), 330.6 bits, see alignment E=5.9e-103

Best Hits

Swiss-Prot: 83% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: K09016, putative pyrimidine permease RutG (inferred from 98% identity to pva:Pvag_0801)

MetaCyc: 83% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>IAI47_12535 pyrimidine utilization transport protein G (Pantoea sp. MT58)
MARSWFPQWQKKSALTENGIIAPDETLPLGQTLVLGLQHAVAMFGATVLMPLLMGLDPNL
AILVSGIGTLLFFFITGGRVPSYLGSSAAFVGVVIAVTGFSGQGLNPNLSVALGGVIACG
VLYTLIGLVVMKSGTRWIENLMPPVVTGAVVMAIGLNLAPIAVHSVSASSFDSWVAVMTV
LCIGLVAVFTHGMIQRLLILVGLILAWAIYAILTNGLGLGKPVDFTMLSQAAWFGLPHTT
APTFDLQAMVLIAPVAIILVAENLGHLKAVAGMTGRNLDPYMGRAFVGDGLATMLSGSIG
GSGVTTYAENIGVMAVTKVYSTLAFVAAAIIAILAGFSPKFGALIHTIPAPVIGGASIVV
FGLIAVAGARIWVQNHVDLGQNSNLIMVATTLVLGAGDFALKIGSFTLGGIGTATFGAII
LNAILRRRSGASQEKPLARQQG