Protein Info for IAI47_12530 in Pantoea sp. MT58

Annotation: pyrimidine utilization flavin reductase protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03615: pyrimidine utilization flavin reductase protein F
  • amino acids 10 to 164 (155 residues), 258.7 bits, E=9.8e-82
• PF01613: Flavin_Reduct
  • amino acids 19 to 165 (147 residues), 132.4 bits, E=7.3e-43

Best Hits

Swiss-Prot: 78% identical to RUTF_YERE8: FMN reductase (NADH) RutF (rutF) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 92% identity to pva:Pvag_0802)

MetaCyc: 70% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.- or 1.5.1.42

Protein Sequence (171 amino acids)

>IAI47_12530 pyrimidine utilization flavin reductase protein F (Pantoea sp. MT58)
MSLETLTSAVEKTEFRNAMSRLGAAVNIITTEGPAGRAGFTASAVCSVTDSPPTLLVCLN
RSASVYSVFRENMQLCVNTLAAGHETLSNLFGGKTPMADRFIAAEWSTAVTGSPVLSGAV
ASFDCRITQIVSVGTHDTLFCEVVGLVRNDDTHGLAWFDRGYHPLMRQDAC