Protein Info for IAI47_12515 in Pantoea sp. MT58

Annotation: pyrimidine utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03614: pyrimidine utilization protein B
  • amino acids 17 to 235 (219 residues), 431 bits, E=5e-134
• PF00857: Isochorismatase
  • amino acids 31 to 228 (198 residues), 135.8 bits, E=9e-44

Best Hits

Swiss-Prot: 84% identical to RUTB_ECO81: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 96% identity to pva:Pvag_0804)

MetaCyc: 84% identical to ureidoacrylate amidohydrolase / (+)-gamma-lactamase monomer (Escherichia coli K-12 JM109)
3.5.2.-; RXN0-6460 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• uracil degradation III (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• cyanuric acid degradation II (4/5 steps found)
• cyanate degradation (2/3 steps found)
• cyanuric acid degradation I (3/5 steps found)
• superpathway of allantoin degradation in yeast (3/6 steps found)
• superpathway of atrazine degradation (4/8 steps found)
• allantoin degradation IV (anaerobic) (3/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Protein Sequence (237 amino acids)

>IAI47_12515 pyrimidine utilization protein B (Pantoea sp. MT58)
MSTVYCAHTQALPQVELPARPEPIAFPPGQTALIVVDMQNAYATEGGYLDLAGFDVSATK
PVIAKIHQAVTAARAAGVQIIWFQNGWDSDYVEAGDAGSPNFHKSNALKTMRKRPELQGT
LLSKGGWDYALVDELVPQPGDIVLPKSRYSGFYNTSLDSTLRSRGIRHLIFTGIATNVCV
ESTLRDGFFLEYFGVVLEDATYQAGPPFAQQAALFNIETFFGWVSDVDTFCESLNTR