Protein Info for IAI47_12460 in Pantoea sp. MT58

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 3 to 166 (164 residues), 126.6 bits, E=5.8e-41
• TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  • amino acids 4 to 179 (176 residues), 202.1 bits, E=5.3e-64

Best Hits

Swiss-Prot: 87% identical to PGSA_PECAS: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 96% identity to pva:Pvag_0815)

MetaCyc: 78% identical to CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [EC: 2.7.8.5]

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin biosynthesis III (3/3 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Protein Sequence (182 amino acids)

>IAI47_12460 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Pantoea sp. MT58)
MQLNIPTCLTLFRVVLIPFFVLAFYLPFIWAPLATALIFIFAAVTDWFDGFLARRWKQTT
RFGAFLDPVADKVLVAIALVLVAEHFHAWWITLPAATMIAREIIISALREWMAEIGKRSS
VSVSWIGKVKTTAQMLSLFALLWRPDATVVAIGVVALYIAAVLTFWSMFQYLSAARGDLL
EP